PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC028521.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 62aa    MW: 7314.57 Da    PI: 10.765
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC028521.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15e-18741135
          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                  C +Cg+ +TplWR+gp  ++ LCnaCG ++r+kg+
  EcC028521.10  7 CYHCGVRETPLWRHGPTEKPVLCNACGSRWRLKGS 41
                  ****************99999************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.2E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.38E-13645No hitNo description
CDDcd002022.30E-14658No hitNo description
Gene3DG3DSA:3.30.50.105.0E-15741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.492757IPR000679Zinc finger, GATA-type
PfamPF003206.0E-16741IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MVKQGPCYHC GVRETPLWRH GPTEKPVLCN ACGSRWRLKG SLDDYVPKRY RAVVRKRRFQ  60
NI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030935.12e-40PREDICTED: GATA transcription factor 27-like
SwissprotQ5PP382e-25GAT27_ARATH; GATA transcription factor 27
TrEMBLA0A078HUW76e-25A0A078HUW7_BRANA; BnaC02g33240D protein
STRINGBra022107.1-P9e-24(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1890268
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.11e-26GATA transcription factor 27